Calculate the precise molecular weight of your peptide sequences based on amino acid residue masses.
Peptide Molecular Weight Calculator
Enter the amino acid sequence using single-letter codes.
No (Standard Residues Only)
Yes (Including common modifications)
Select 'Yes' to include masses for common N-terminal acetylation and C-terminal amidation.
Calculation Results
— Da
Number of Residues: —
Average Residue Mass: — Da
Water Mass (H2O): — Da
Formula: Molecular Weight = Σ(Residue Mass) + 2 * Mass(H) + Mass(O) – Σ(H2O lost during peptide bond formation)
The calculator sums the monoisotopic masses of the standard amino acid residues, adds the mass of one oxygen and two hydrogens (for the terminal water molecule lost during peptide bond formation), and accounts for any specified modifications.
Amino Acid Residue Mass Distribution
This chart visualizes the distribution of monoisotopic masses for each amino acid in your sequence. It helps understand the contribution of different residues to the overall peptide mass.
What is a Peptide Molecular Weight Calculator (EXpasy Method)?
A Peptide Molecular Weight Calculator, particularly one employing the EXpasy method, is a specialized online tool designed to accurately determine the molecular mass of a peptide sequence. Proteins are long chains of amino acids linked by peptide bonds. When these bonds form, a molecule of water (H₂O) is released. Therefore, the mass of a peptide is not simply the sum of the masses of its constituent amino acids. The EXpasy method, widely adopted in bioinformatics and proteomics, uses standard, well-defined residue masses and accounts for the water loss during peptide bond formation, as well as any terminal modifications. This tool is indispensable for researchers working with synthetic peptides, analyzing protein digests, or verifying the identity of peptides in mass spectrometry experiments.
Who should use it:
Biochemists and Molecular Biologists: Verifying synthesized peptides, interpreting experimental results.
Proteomics Researchers: Analyzing protein identification data from mass spectrometry.
Drug Discovery Scientists: Characterizing peptide-based therapeutics.
Students and Educators: Learning about peptide structure and composition.
Common Misconceptions:
Simple Summation: Many assume peptide mass is just the sum of amino acid masses. This overlooks the dehydration during peptide bond formation.
Average vs. Monoisotopic Mass: This calculator provides the monoisotopic mass (mass of the most abundant isotope of each atom). Average molecular weight (using average atomic weights) is also used but is less precise for many experimental contexts like mass spectrometry.
Ignoring Modifications: Standard calculations often miss modifications like N-terminal acetylation or C-terminal amidation, which significantly alter the mass.
Peptide Molecular Weight Calculator Formula and Mathematical Explanation
The core principle behind calculating peptide molecular weight is to sum the masses of the individual amino acid residues and then adjust for the formation of peptide bonds and terminal groups. The EXpasy standard accounts for the loss of water during amide bond formation.
The Formula Derivation:
A peptide is formed by linking amino acids (AA) in a chain:
AA₁ – AA₂ – AA₃ – … – AAn
Each peptide bond (-CO-NH-) forms via a dehydration reaction, where one molecule of water (H₂O) is lost per bond. For a peptide of 'n' amino acids, there are 'n-1' peptide bonds.
The mass of the peptide can be expressed as:
Molecular Weight (Peptide) = Σ (Mass of residue i) + Mass of N-terminus + Mass of C-terminus – (n-1) * Mass(H₂O)
However, a more practical approach used by tools like the EXpasy calculator defines the "residue mass" as the mass of the amino acid minus the mass of water. This simplifies the formula:
Molecular Weight (Peptide) = Σ (Mass of AA residue i [as defined by EXpasy]) + Mass(H at N-terminus) + Mass(OH at C-terminus)
This is equivalent to:
Molecular Weight (Peptide) = Σ (Monoisotopic Mass of standard Amino Acid Residue) + Mass of Terminal Water Molecule
The terminal water molecule's mass (H₂O) is accounted for by adding the mass of one hydrogen atom (H) to the N-terminus and the mass of a hydroxyl group (OH) to the C-terminus. This effectively sums to the mass of the intact amino acid plus the mass of a single hydrogen atom.
For standard calculation (no modifications):
MW = Σ(Monoisotopic Residue Mass) + 1.007825 (H) + 15.994915 (O)
Where Σ(Monoisotopic Residue Mass) is the sum of the masses of the individual amino acid residues as defined by EXpasy (which already accounts for water loss *within* the chain).
If common modifications are selected (e.g., N-terminal acetylation, C-terminal amidation):
MW = MW (Standard) + Mass(Modification 1) + Mass(Modification 2) …
Variables Table:
Key Variables in Peptide Molecular Weight Calculation
Variable
Meaning
Unit
Typical Range / Value
Peptide Sequence
Order of amino acids
N/A
1 to thousands of characters
Amino Acid Residue Mass
Monoisotopic mass of a single amino acid minus H₂O
Daltons (Da)
~71.0 (Ala) to ~204.1 (Trp)
Terminal H
Mass of Hydrogen atom at N-terminus
Da
1.007825
Terminal O
Mass of Oxygen atom at C-terminus
Da
15.994915
Water Mass (H₂O)
Mass lost per peptide bond / Mass added for termini
Da
18.010565
N-terminal Acetyl (Ac)
Mass of acetyl group modification
Da
42.010565
C-terminal Amide (NH₂)
Mass of amide group modification
Da
16.022097
Practical Examples (Real-World Use Cases)
Understanding peptide molecular weight is crucial in various experimental settings. Here are practical examples:
Example 1: Standard Peptide Synthesis Verification
A researcher synthesizes a short peptide, GLP-1(7-36) amide, a biologically active form of GLP-1. The sequence is HGEGTFTSDVSSYLEEQAAKEFIAWLVKGRG. They need to verify its mass after synthesis.
Inputs:
Peptide Sequence: HGEGTFTSDVSSYLEEQAAKEFIAWLVKGRG
Is Modified: Yes (Assuming C-terminal amidation is standard for this biologically active form)
Calculation Process (Simplified):
The calculator sums the monoisotopic masses of all 30 amino acid residues (Histidine, Glycine, Glutamic Acid, etc.), adds the terminal H (1.0078 Da), and adds the mass for C-terminal amidation (replacing the C-terminal OH with NH₂ is equivalent to adding NH₂ and removing O, netting +16.022 Da compared to a standard acid).
Expected Output:
Number of Residues: 30
Molecular Weight: Approximately 3050.6 Da (Actual calculated value depends on precise residue masses used)
Interpretation:
The calculated molecular weight should match the expected theoretical mass determined by mass spectrometry. A discrepancy might indicate errors in synthesis or the presence of unintended modifications.
Example 2: Peptide Digestion Analysis
A protein is digested using Trypsin, which cleaves after Arginine (R) and Lysine (K). A resulting peptide fragment has the sequence KYGGEFGS. The researcher wants to know its mass to look for it in a mass spectrometry run.
Inputs:
Peptide Sequence: KYGGEFGS
Is Modified: No (Standard residues)
Calculation Process:
The calculator sums the monoisotopic masses of the 8 amino acid residues (Lysine, Tyrosine, Glycine, Glutamic Acid, Glycine, Phenylalanine, Glycine, Serine). It then adds the mass of the terminal Hydrogen (1.0078 Da) and the terminal Hydroxyl group (15.9949 Da), as this is a standard peptide fragment ending in a carboxyl group.
Expected Output:
Number of Residues: 8
Molecular Weight: Approximately 965.4 Da
Interpretation:
This precise mass can be used as a target value in mass spectrometry software to identify this specific peptide fragment within a complex mixture, aiding in protein identification and quantification. The peptide molecular weight calculator provides the exact theoretical mass needed for this analysis.
How to Use This Peptide Molecular Weight Calculator
Using this calculator is straightforward and designed for quick, accurate results. Follow these steps:
Enter Peptide Sequence: In the "Peptide Sequence" field, type or paste the amino acid sequence using the standard one-letter codes (e.g., ACDEFGHIKLMNPQRSTVWY). Ensure there are no spaces or non-standard characters unless you are analyzing modified residues not covered by the basic options.
Select Modifications: If your peptide has common modifications like N-terminal acetylation or C-terminal amidation, select "Yes" for "Is this a modified peptide?". The calculator will automatically add the corresponding mass increments. For peptides without these specific modifications, select "No".
Calculate: Click the "Calculate Molecular Weight" button.
Review Results: The calculator will display:
Primary Result: The calculated Molecular Weight in Daltons (Da).
Intermediate Values: The total number of residues, the average residue mass, and the mass of a standard water molecule (H₂O), which is relevant to peptide bond formation.
Chart: A visual representation of the mass distribution of amino acid residues in your sequence.
Copy Results: Use the "Copy Results" button to copy all calculated values and assumptions to your clipboard for use in reports or other documents.
Reset: Click the "Reset" button to clear all fields and return to the default state.
How to Read Results:
The main result is the Molecular Weight in Daltons (Da). This is the monoisotopic mass. The number of residues tells you the length of your peptide. The average residue mass provides a general sense of the mass contributed per amino acid. The water mass (H₂O) highlights the mass consideration for peptide bond formation.
Decision-Making Guidance:
Use the calculated molecular weight to:
Confirm the identity and purity of synthesized peptides.
Predict the mass of peptide fragments in proteomic analysis.
Design experiments involving peptides.
Troubleshoot unexpected results in mass spectrometry.
Compare the calculated value to experimental data. Deviations may indicate post-translational modifications, incomplete reactions, or errors.
Key Factors That Affect Peptide Molecular Weight Results
While the calculation seems simple, several factors critically influence the final peptide molecular weight:
Amino Acid Sequence: This is the most fundamental factor. Each amino acid has a unique monoisotopic mass. A sequence change directly alters the total molecular weight. For example, substituting a Tryptophan (Trp) with Alanine (Ala) significantly decreases the mass.
Peptide Bond Formation (Dehydration): As discussed, each peptide bond formation results in the loss of a water molecule (18.01 Da). This effect is cumulative and integral to the calculation. Ignoring it leads to overestimation of mass.
N-terminal Modification: Common modifications like N-terminal acetylation (adding an acetyl group, +42.01 Da) are frequent in nature and synthesis. If present, this mass must be added.
C-terminal Modification: C-terminal amidation (replacing -COOH with -CONH₂) is another common modification, adding approximately +16.02 Da compared to a standard carboxyl terminus. This significantly affects the final mass.
Other Post-Translational Modifications (PTMs): Beyond acetylation and amidation, peptides can undergo phosphorylation (+79.96 Da), glycosylation, methylation (+14.01 Da), etc. This calculator simplifies by only including common ones, but extensive PTMs require specialized calculations.
Isotopic Composition: This calculator uses monoisotopic masses. While most precise, real-world samples contain mixtures of isotopes (e.g., ¹³C, ¹⁵N). This results in isotopic peaks in mass spectrometry but doesn't change the fundamental monoisotopic mass calculation.
Protonation State: In mass spectrometry, peptides are often ionized (e.g., by adding protons, H⁺). While ionization affects the *mass-to-charge ratio (m/z)*, the underlying molecular weight calculation remains the same before ionization.
Frequently Asked Questions (FAQ)
What is the difference between molecular weight and molar mass?
Molecular weight typically refers to the mass of a single molecule (often expressed in Daltons, Da), while molar mass is the mass of one mole of a substance (expressed in grams per mole, g/mol). For practical purposes in peptide calculations, the numerical value is the same, but the units differ. This calculator provides molecular weight in Daltons.
Why use Daltons (Da) instead of atomic mass units (amu)?
Dalton (Da) is the standard unit for molecular mass in biochemistry and molecular biology. It is defined as 1/12 the mass of an unbound neutral atom of carbon-12 in its ground state. It is essentially equivalent to the atomic mass unit (amu) for practical calculations in this field.
Does the calculator handle unusual or non-standard amino acids?
This specific calculator is designed for standard amino acids and includes options for common N-terminal acetylation and C-terminal amidation. It does not have built-in support for a comprehensive list of all known non-standard amino acids or complex PTMs. For those, you would need a more advanced tool or manual calculation using specific residue masses.
What is the significance of the "Water Mass (H2O)" result?
The water mass (18.010565 Da) represents the mass lost during the formation of *each* peptide bond. While the calculator ultimately sums residue masses and adds terminal atoms, understanding this value helps grasp the chemistry of peptide formation and why a peptide's mass is less than the sum of intact amino acid masses.
How accurate is the calculated molecular weight?
The accuracy depends on the precision of the residue mass data used and whether all relevant modifications are accounted for. This calculator uses standard monoisotopic masses and accounts for common modifications, providing a highly accurate theoretical value. Experimental determination (e.g., via mass spectrometry) may show slight variations due to factors like isotopic distribution and experimental conditions.
Can this calculator determine the mass of a cyclic peptide?
No, this calculator is designed for linear peptides. Cyclic peptides involve additional peptide bonds formed by cyclization, which results in further loss of water molecules compared to a linear counterpart of the same amino acid sequence. A different calculation method is required for cyclic peptides.
What if my peptide sequence contains D-amino acids?
Standard amino acid residue masses typically refer to L-amino acids. D-amino acids have the same elemental composition and therefore the same molecular weight as their L-enantiomers. So, for molecular weight calculation purposes alone, they are treated identically.
How do I interpret the chart?
The chart shows the frequency and relative mass contribution of each amino acid type present in your specific peptide sequence. It helps visualize which amino acids are most abundant and their individual masses, offering insights into the sequence's overall composition.
Related Tools and Internal Resources
ExPASy PROTPARAM ToolA comprehensive suite for protein and peptide analysis, including molecular weight and isoelectric point calculation.
Protein Analysis Tools HubExplore our collection of tools for protein sequence analysis and characterization.